albumin binding raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-07-15. Anything still debated is marked as such rather than presented as settled.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
Two related forms appear under the CJC-1295 name. The simpler analogue, commonly written as modified GRF(1-29), carries the four substitutions but no additional conjugation. The second form attaches a maleimidopropionic acid linker to a lysine residue, a modification frequently called the drug affinity complex. That linker reacts with the free thiol on serum albumin to form a covalent bond. Because albumin has a long residence time in blood, the conjugated peptide stays in circulation far longer than the unconjugated analogue.
Research material is normally supplied as a freeze-dried powder in sealed vials. In that state the peptide is comparatively robust, but prolonged exposure to warmth, moisture, or light accelerates degradation. Storage at minus twenty degrees Celsius or lower, with desiccant and protection from light, is the commonly described practice. Vials should be allowed to reach room temperature before opening to limit condensation on the powder. Moisture uptake during handling is a recognized source of variability in later measurements.
Reconstitution is typically performed with sterile water or bacteriostatic water, added slowly against the vial wall. The resulting solution should be clear and colorless; cloudiness or visible particles suggest a problem with the material or the diluent. Once in solution, the peptide is less stable than the dry powder. Refrigerated storage at two to eight degrees Celsius is common for short-term holding, while freezing aliquots is described for longer periods.
Purity is most often assessed by reversed-phase high-performance liquid chromatography, reported as a percentage of total peak area. Identity is confirmed by mass spectrometry, which yields a molecular ion consistent with the expected sequence. Amino acid analysis and peptide mapping provide additional characterization. Reported purity values are method-dependent, so figures from different laboratories are not always directly comparable without details of column, gradient, and detection wavelength.
| Property | Value | Notes |
|---|---|---|
| Peptide class | Synthetic GHRH analogue | Built on a 29 residue sequence |
| Primary target | GHRH receptor (GHRHR) | Class B G protein coupled receptor |
| Unconjugated half life | Minutes | Limited by protease degradation |
| Key modification | Four residue substitutions | Positions 2, 8, 15 and 27 |
| Common synonym | Modified GRF(1-29) | Usually denotes the form without DAC |
Both forms act at the pituitary receptor for growth hormone-releasing hormone and increase growth hormone output, which in turn raises insulin-like growth factor 1. A long-acting analog produces sustained rather than pulsatile stimulation, and the physiological consequences of that pattern are not fully settled. Published human data on the extended form remain limited, and much of what circulates in discussion traces to early company reports rather than independent replication. How sustained exposure affects normal feedback remains an open question.
The distinguishing feature of the DAC form is a maleimide-containing group that reacts with the free thiol of cysteine-34 on human serum albumin. This reaction forms a covalent bond without enzymatic assistance, and it takes place after the peptide enters the bloodstream. Because albumin is abundant and long-lived, the attached peptide is carried through circulation far longer than an unmodified fragment would survive. The chemistry is a deliberate pharmacokinetic strategy rather than a change to receptor activity.
Enzymatic protection is a separate mechanism from plasma protein binding. The four substitutions in the backbone reduce recognition by dipeptidyl peptidase IV, which normally cleaves the natural hormone within minutes. Without the reactive group, this resistance still yields only a short window of activity, generally reported in the range of tens of minutes. With it, reported half-lives in early human work extended to several days. The size of that gap is the main practical distinction between the two materials.
Two related peptides circulate under the CJC-1295 label, and they differ mainly in how long they persist in circulation. The version carrying a drug affinity complex includes a maleimidopropionic acid linker that forms a covalent bond with serum albumin. The other version, usually written as modified GRF(1-29) or tetrasubstituted GRF(1-29), lacks that linker and is cleared quickly. Mixing the two produces inconsistent readings of published half-life values, because the linker rather than the receptor-facing sequence drives most of the difference.
The core sequence keeps the receptor-binding region of GHRH while replacing four positions that are vulnerable to dipeptidyl peptidase-4 and other proteases. Substitutions at positions 2, 8, 15, and 27 raise metabolic stability relative to the natural hormone. The N-terminal residues remain essential for activity, so changes there generally lower potency. Molecular weight sits near 3368 daltons for the tetrasubstituted analog without the linker, while the albumin-binding form is heavier because of the added maleimide group.
Downstream of growth hormone, the liver and other tissues increase production of insulin-like growth factor 1, a mediator of many growth-promoting effects. Studies have documented elevated levels of both hormones after dosing, and the rise from the long-acting form persists longer than that produced by shorter-acting analogues. What remains unclear is whether sustained elevation of these markers translates into meaningful clinical benefit, and whether prolonged exposure carries risks that short trials could not detect.
CJC-1295 acts at the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in cyclic AMP and calcium entry, which promotes release of stored growth hormone. Because the peptide mimics the body's own releasing hormone, it amplifies existing secretory pulses rather than driving continuous output. The size of the response therefore depends partly on the subject's own hormonal rhythm and feedback state.
The dividing feature between the two forms is a maleimide-based drug affinity complex, abbreviated DAC. In the DAC-bearing version, a linker attaches the peptide to serum albumin after administration, and that association slows removal from plasma. The version lacking DAC appears in catalogs as MOD GRF(1-29) or tetrasubstituted GRF(1-29). Because informal writing treats both as one item, comparisons drawn from such sources routinely blend measurements taken from two molecules with substantially different behavior.
Four amino acid substitutions separate the modified backbone from the parent GRF(1-29) sequence. These changes reduce recognition by dipeptidyl peptidase IV and related proteases, extending the interval before degradation. Development work in this area sought longer-acting GHRH analogs for endocrine investigation. Published descriptions treat the substitution set as a defining property of the core sequence, while the albumin-binding linker is described separately as an optional addition to that same backbone.
== Silicon-34 == Silicon-34 is a radioactive isotope with a half-life of 2.8 seconds. In addition to the usual N = 20 closed shell, the nucleus also shows a strong Z = 14 shell closure, making it behave like a doubly magic spherical nucleus, except that it is also located two protons above an island of inversion. Silicon-34 has an unusual "bubble" structure where the proton distribution is less dense at the center than near the surface, as the 2s1/2 proton orbital is almost unoccupied in the ground state, unlike in 36S where it is almost full. Silicon-34 is one of the known cluster decay emission particles; it is produced in the decay of 242Cm with a branching ratio of approximately 1×10−16.
The Houthis joined the war on 28 March launching a ballistic missile towards Israel while stating that they had launched ballistic missiles targeting "sensitive" military sites in Israel; the missile was intercepted and no casualties were reported. The Houthis subsequently launched a second missile at Eilat. In response, the internationally recognized Yemeni government condemned Iran's "frequent attempts to drag Yemen" into conflict "through its terrorist militias". On the same day, 2,500 US marines from the 31st Marine Expeditionary Unit arrived in the Middle East, expected to be part of US efforts to open the Strait of Hormuz. US Central Command (CENTCOM) stated that it had struck over 11,000 targets in Iran since the beginning of the war. On 28 March, joint US–Israeli airstrikes severely damaged several residential and civilian facilities, including the Iran University of Science and Technology. In response, Iran threatened to attack Israeli and American colleges across the Middle East. Airstrikes also struck a 10,000-cubic-metre (350,000 cu ft) water reservoir in Haftkel, in Khuzestan province. An Iranian missile struck a chemical plant in the Ne'ot Hovav industrial zone, injuring one person and causing fears of a hazardous leak. A convoy of the Iraqi Popular Mobilization Forces was seen entering Khorramshahr in southwestern Iran. Eleven-year-old child soldier Alireza Jafari was killed in an Israeli drone strike "while serving" at a checkpoint on a Tehran highway; Amnesty International called the organized Iranian recruitment of children as young as Jafari a war crime.
Leather is a strong, flexible and durable material obtained from the tanning, or chemical treatment, of animal skins and hides to prevent decay. The most common leathers come from cattle, sheep, goats, equine animals, buffalo, pigs and hogs, ostriches, and aquatic animals such as seals and alligators. Leather can be used to make a variety of items, including clothing, footwear, handbags, furniture, tools and sports equipment, and lasts for decades. Leather making has been practiced for more than 7,000 years and the leading producers of leather today are China and India. Critics of tanneries claim that they engage in unsustainable practices that pose health hazards to the people and the environment near them.
== Biological role and precautions == Erbium does not have a biological role, but erbium salts can stimulate metabolism. Humans consume 1 milligram of erbium a year on average. The highest concentration of erbium in humans is in the bones, but there is also erbium in the human kidneys and liver. Erbium is slightly toxic if ingested, but erbium compounds are generally not toxic. Ionic erbium behaves similar to ionic calcium, and can potentially bind to proteins such as calmodulin. When introduced into the body, nitrates of erbium, similar to other rare earth nitrates, increase triglyceride levels in the liver and cause leakage of hepatic (liver-related) enzymes to the blood, though they uniquely (along with gadolinium and dysprosium nitrates) increase RNA polymerase II activity. Ingestion and inhalation are the main routes of exposure to erbium and other rare earths, as they do not diffuse through unbroken skin. Metallic erbium in dust form presents a fire and explosion hazard.
Sources: en.wikipedia.org
In 1999 its parent company reorganized and changed its name to PE Corporation, and the PE Biosystems Group (formerly again became publicly traded, as a tracking stock of its parent, along with its sister tracking stock company, Celera Genomics. In 2000 the parent became Applera Corporation. The Applied Biosystems name also returned that year, in the name change of the tracking stock from PE Biosystems Group to Applera Corporation-Applied Biosystems Group, an S&P 500 company, which remains as a publicly traded operating group within Applera Corp., along with its sibling operating group, Applera Corporation-Celera Group. Applera derives its name from the combination of its two component groups' names, Appl(iedCel)era In November 2008, a merger between Applied Biosystems and Invitrogen was finalized "creating a global leader in biotechnology reagents and systems". The new company was called Life Technologies.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Scarborough (; 2021 Census 623,610) is a district of Toronto, Ontario, Canada, situated in the eastern part of Toronto. Its borders are Victoria Park Avenue to the west, Steeles Avenue and the city of Markham to the north, Rouge River and the city of Pickering to the east, and Lake Ontario to the south. Scarborough was named after the English town of Scarborough, North Yorkshire, inspired by its cliffs. Scarborough is the site of several former Indigenous settlements dating back many centuries. It was settled by Europeans in the 1790s and has grown from a collection of small rural villages and farms to become a fully urbanized and diverse cultural community. Incorporated in 1850 as a township, the district became part of Metropolitan Toronto in 1953 and was reconstituted as a borough in 1967. The borough rapidly developed as a suburb of Toronto over the next decade and became a city in 1983. In 1998, the city and the rest of Metropolitan Toronto were amalgamated into the present city of Toronto. The Scarborough Civic Centre – the former city's last seat of government – now houses offices of the municipal government of Toronto. Since the end of the Second World War, the district has been a popular destination for new immigrants in Canada. As a result, it is one of the most diverse and multicultural areas in the Greater Toronto Area, being home to various religious groups and places of worship. It includes a number of natural landmarks, including the Toronto Zoo, Rouge Park, and the Scarborough Bluffs.
Jammu and Kashmir (abbr. J&K) is a region administered by India as a union territory consisting of the southern portion of the larger Kashmir region, which has been the subject of a border dispute between India and Pakistan since 1947 and between India and China since 1959. The Line of Control separates Jammu and Kashmir from the Pakistani-administered territories of Azad Kashmir and Gilgit-Baltistan in the west and north respectively. It lies to the north of the Indian states of Himachal Pradesh and Punjab and to the west of Ladakh which is administered by India as a union territory. Insurgency in Jammu and Kashmir has persisted in protest over autonomy and rights. In 2019, the Jammu and Kashmir Reorganisation Act was passed, reconstituting the former state of Jammu and Kashmir into two union territories: Ladakh in the east and the residuary Jammu and Kashmir in the west. Srinagar and Jammu jointly serve as the capital of the region, which is divided into two divisions and 20 districts. Jammu and Kashmir holds substantial mineral deposits, including sapphire, borax, and graphite. Agriculture and services drive the economy, with major contributors being horticulture, handicrafts, and tourism. Apple cultivation is one of the largest industries, employing 3.5 million people and producing 10% of the gross state domestic product. Despite these activities, over 10% of the population lives below the national poverty line.
=== Biosynthesis === Anthranilic acid is biosynthesized from chorismic acid by the action of anthranilate synthase. In organisms capable of tryptophan synthesis, anthranilate is a precursor to the amino acid tryptophan via the attachment of phosphoribosyl pyrophosphate to the amine group. After then, cyclization occurs to produce indole.
Sources: en.wikipedia.org
Molecular dimers are often formed by the reaction of two identical compounds e.g.: 2A → A−A. In this example, monomer "A" is said to dimerize to give the dimer "A−A". Dicyclopentadiene is an asymmetrical dimer of two cyclopentadiene molecules that have reacted in a Diels-Alder reaction to give the product. Upon heating, it "cracks" (undergoes a retro-Diels-Alder reaction) to give identical monomers:
=== International === By March 2014, Dunkin' Donuts' largest international market was South Korea, representing nearly 40 percent of all international sales. With over 900 outlets in the country, it had three times as many as McDonald's and about a third more than Starbucks. South Korea is home to Dunkin' Donuts' only coffee roasting plant outside the U.S. The company still sees China and its vastly larger population as the more lucrative opportunity. In 2008, Dunkin' Donuts opened its first restaurant in Shanghai, representing the first step in its China expansion strategy. By March 2014, it had about 50 stores in the country and an agreement to open 100 more over the next five years. The operation in China is under a franchise agreement with Jollibee Foods Cooperation, but only seven stores were opened in Beijing, opposed to the planned 100. In 2022, Jollibee announced that it will end the Dunkin Donuts franchise in China to allow expansions into other markets in other regions. Since then, stores started to close and as of 2025, there are no Dunkin stores in mainland China. In Australia, Dunkin' Donuts opened in the 1980s, but by the late 2000s, they had left the Australian market. In 2014, Dunkin' Brands global chairman Nigel Travis said there were no plans in the short term to return the brand to the Australian market. Baskin-Robbins, a subsidiary of Dunkin' Brands, continues to exist in the country. In Brazil, Dunkin' Donuts opened its first building in 1980. In 2013, it planned to open 25 franchises in the country.
The most expensive process was to preserve the body by dehydration and protect against pests, such as insects. Almost all of the actions Herodotus described served one of these two functions. First, the brain was removed from the cranium through the nose; the gray matter was discarded. Modern mummy excavations have shown that instead of an iron hook inserted through the nose as Herodotus claims, a rod was used to liquefy the brain via the cranium, which then drained out the nose by gravity. The embalmers then rinsed the skull with certain drugs that mostly cleared any residue of brain tissue and also had the effect of killing bacteria. Next, the embalmers made an incision along the flank with a sharp blade fashioned from an Ethiopian stone and removed the contents of the abdomen. Herodotus does not discuss the separate preservation of these organs and their placement either in special jars or back in the cavity, a process that was part of the most expensive embalming, according to archaeological evidence. The abdominal cavity was then rinsed with palm wine and an infusion of crushed, fragrant herbs and spices; the cavity was then filled with spices including myrrh, cassia, and, Herodotus notes, "every other sort of spice except frankincense", also to preserve the person. The body was further dehydrated by placing it in natron, a naturally occurring salt, for 70 days. Herodotus insists that the body did not stay in the natron longer than 70 days.
A descriptor which is applied to any substance or process which is being investigated for clinical use but either has not commenced, or has not completed, clinical trials. Examples: candidate vaccine, candidate formulation. Case report
Sources: en.wikipedia.org
The names are often used interchangeably in casual writing, but they are not strictly identical. Modified GRF(1-29) refers to the unconjugated analogue carrying only the four substitutions. The version sold as CJC-1295 with DAC includes the albumin binding linker and clears much more slowly.
DAC stands for drug affinity complex, a term describing the maleimidopropionic acid linker. This group forms a covalent bond with the cysteine residue on serum albumin after administration. The resulting adduct is what extends the circulating half life from minutes to days.
No. It is entirely synthetic and does not correspond to any known endogenous peptide. The design starts from human growth hormone releasing hormone and introduces deliberate substitutions. Any biological effect comes from mimicking the natural hormone at its receptor.
Cool, dark, and dry conditions are standard, with storage at minus twenty degrees Celsius or below. Desiccant and sealed vials limit moisture uptake. Repeated warming and cooling of the container is generally avoided.